SCOPe 2.08: Domain d3q3gb1: 3q3g B:11-226

Lineage for d3q3gb1 (3q3g B:11-226)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

Domain d3q3gb1: 3q3g B:11-226 [408589]
Other proteins in same PDB: d3q3ga1, d3q3ga2, d3q3gb2, d3q3gc1, d3q3gc2, d3q3gd2, d3q3ge_, d3q3gf1, d3q3gf2, d3q3gg_, d3q3gh2, d3q3gi_, d3q3gj1, d3q3gj2, d3q3gk2, d3q3gl_
automated match to d6shgh_
complexed with ca, cl, edo, gol, na, peg

Details for d3q3gb1

PDB Entry: 3q3g (more details), 2.7 Å

PDB Description: Crystal Structure of A-domain in complex with antibody

PDB Compounds: (B:) antibody heavy chain

SCOPe Domain Sequences for d3q3gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q3gb1 b.1.1.1 (B:11-226) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aelvkpgasvklsctpsgfnikdiymqwvkqrpeqglewigridpandktkydpkfqgka
titadtssntaylqlssltsedtavyycaseghygydgyamdywgqgttvtvssakttpp
svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOPe Domain Coordinates for d3q3gb1:

Click to download the PDB-style file with coordinates for d3q3gb1.
(The format of our PDB-style files is described here.)

Timeline for d3q3gb1: