SCOPe 2.08: Domain d3mbxh1: 3mbx H:1-224

Lineage for d3mbxh1 (3mbx H:1-224)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3mbxh1: 3mbx H:1-224 [408471]
   Other proteins in same PDB: d3mbxh2, d3mbxl2
   automated match to d6shgh_
   complexed with na, po4

Details for d3mbxh1

PDB Entry: 3mbx, 1.6 Å

PDB Description: crystal structure of chimeric antibody x836

PDB Compounds: (H:) x836 heavy chain

SCOPe Domain Sequences for d3mbxh1:

Sequence; same for both SEQRES and ATOM records:

>d3mbxh1 b.1.1.0 (H:1-224) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evtlkesgpgilqpsqtlsltcsfsgfslstygmgvgwirqpsgkglewlahiwwddvkr
ynpalksrltiskdtsgsqvflkiasvdtsdtatyycarmgsdydvwfdywgqgtlvtvs
aastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d3mbxh1:

• d3mbxh1 is new in SCOPe 2.08-stable