Lineage for d3i9gh_ (3i9g H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759585Domain d3i9gh_: 3i9g H: [408412]
    Other proteins in same PDB: d3i9gl2
    automated match to d6shgh_
    complexed with ca, mg, s1p

Details for d3i9gh_

PDB Entry: 3i9g (more details), 1.9 Å

PDB Description: crystal structure of the lt1009 (sonepcizumab) antibody fab fragment in complex with sphingosine-1-phosphate
PDB Compounds: (H:) Sonepcizumab antibody Fab fragment, heavy chain

SCOPe Domain Sequences for d3i9gh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i9gh_ b.1.1.0 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvqsgaevkkpgeslkiscqsfgyifidhtihwmrqmpgqglewmgaisprhditky
nemfrgqvtisadkssstaylqwsslkasdtamyfcarggfygstiwfdfwgqgtmvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepk

SCOPe Domain Coordinates for d3i9gh_:

Click to download the PDB-style file with coordinates for d3i9gh_.
(The format of our PDB-style files is described here.)

Timeline for d3i9gh_:

  • d3i9gh_ is new in SCOPe 2.08-stable