Lineage for d2vxuh_ (2vxu H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744905Domain d2vxuh_: 2vxu H: [408234]
    Other proteins in same PDB: d2vxul1, d2vxul2, d2vxum1, d2vxum2
    automated match to d6shgh_

Details for d2vxuh_

PDB Entry: 2vxu (more details), 2.36 Å

PDB Description: crystal structure of murine reference antibody 125-2h fab fragment
PDB Compounds: (H:) murine igg 125-2h

SCOPe Domain Sequences for d2vxuh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vxuh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eiqlqqsgpelvkpgasvkvsckasgysftdyfiywvkqshgkslewigdidpyngdtsy
nqkfrdkatltvdqssttafmhlnsltsedsavyfcarglrfwgqgtlvtvsaakttpps
vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpsstwpsetvtcnvahpasstkvdkkivprdcg

SCOPe Domain Coordinates for d2vxuh_:

Click to download the PDB-style file with coordinates for d2vxuh_.
(The format of our PDB-style files is described here.)

Timeline for d2vxuh_:

  • d2vxuh_ is new in SCOPe 2.08-stable