Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries) Uniprot P01892 25-298 |
Domain d2bsvd3: 2bsv D:1-181 [408029] Other proteins in same PDB: d2bsva4, d2bsvb2, d2bsvb3, d2bsvd4, d2bsve2, d2bsve3 automated match to d1akja2 |
PDB Entry: 2bsv (more details), 1.6 Å
SCOPe Domain Sequences for d2bsvd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bsvd3 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d2bsvd3: