Lineage for d2ajuh_ (2aju H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744181Domain d2ajuh_: 2aju H: [408006]
    Other proteins in same PDB: d2ajul1, d2ajul2
    automated match to d6shgh_

Details for d2ajuh_

PDB Entry: 2aju (more details), 1.5 Å

PDB Description: Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
PDB Compounds: (H:) Antibody 7A1 Fab'

SCOPe Domain Sequences for d2ajuh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajuh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklsesgpglvkpsqslsltctvtgysittnyawtwirqfpgnklewmgyirssvitry
npslksrisitqdtsknqfflqlnsvttedtatyycarydyygntgdywgqgtsvtvssa
kttppsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytltssvtvpsstwpsqtvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d2ajuh_:

Click to download the PDB-style file with coordinates for d2ajuh_.
(The format of our PDB-style files is described here.)

Timeline for d2ajuh_:

  • d2ajuh_ is new in SCOPe 2.08-stable