Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
Family c.51.4.0: automated matches [191335] (1 protein) not a true family |
Protein automated matches [190179] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187020] (7 PDB entries) |
Domain d6xi5a_: 6xi5 A: [407315] automated match to d2p5xa_ complexed with so4 |
PDB Entry: 6xi5 (more details), 2.61 Å
SCOPe Domain Sequences for d6xi5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xi5a_ c.51.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} llhkrvvlasasprrqeilsnaglrfevvpskfkekldkasfatpygyametakqkalev anrlyqkdlrapdvvigadtivtvgglilekpvdkqdayrmlsrlsgrehsvftgvaivh csskdhqldtrvsefyeetkvkfselseellweyvhsgepmdkaggygiqalggmlvesv hgdflnvvgfplnhfckqlvklyy
Timeline for d6xi5a_: