Lineage for d1e3pa6 (1e3p A:152-262)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967341Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2967342Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2967343Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 2967455Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 [55668] (1 species)
    duplication of two-domain units formed by domains 1-2 and 4-5
  7. 2967456Species Streptomyces antibioticus [TaxId:1890] [55669] (2 PDB entries)
  8. 2967457Domain d1e3pa6: 1e3p A:152-262 [40697]
    Other proteins in same PDB: d1e3pa1, d1e3pa2, d1e3pa3, d1e3pa4, d1e3pa5
    complexed with so4, wo4

Details for d1e3pa6

PDB Entry: 1e3p (more details), 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme
PDB Compounds: (A:) Polyribonucleotide nucleotidyltransferase

SCOPe Domain Sequences for d1e3pa6:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3pa6 d.101.1.1 (A:152-262) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus [TaxId: 1890]}
fsgpiggvrvalirgqwvafpthteledavfdmvvagrvledgdvaimmveaeatektiq
lvkdgaeapteevvaagldaakpfikvlckaqadlaakaakptgefpvfld

SCOPe Domain Coordinates for d1e3pa6:

Click to download the PDB-style file with coordinates for d1e3pa6.
(The format of our PDB-style files is described here.)

Timeline for d1e3pa6: