Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (178 PDB entries) |
Domain d5s5ne_: 5s5n E: [406873] Other proteins in same PDB: d5s5na1, d5s5na2, d5s5nb1, d5s5nb2, d5s5nc1, d5s5nc2, d5s5nd1, d5s5nd2, d5s5nf1, d5s5nf2, d5s5nf3 automated match to d4i55e_ complexed with acp, ca, gdp, gtp, mes, mg, w0y |
PDB Entry: 5s5n (more details), 2.9 Å
SCOPe Domain Sequences for d5s5ne_:
Sequence, based on SEQRES records: (download)
>d5s5ne_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelkeea
>d5s5ne_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke ea
Timeline for d5s5ne_: