Lineage for d1qb3a_ (1qb3 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2573697Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2573698Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2573699Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 2573700Protein cks1 [55641] (1 species)
  7. 2573701Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55642] (1 PDB entry)
  8. 2573702Domain d1qb3a_: 1qb3 A: [40680]

Details for d1qb3a_

PDB Entry: 1qb3 (more details), 3 Å

PDB Description: crystal structure of the cell cycle regulatory protein cks1
PDB Compounds: (A:) cyclin-dependent kinases regulatory subunit

SCOPe Domain Sequences for d1qb3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qb3a_ d.97.1.1 (A:) cks1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hafqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgt
lriltedewrglgitqslgwehyechapephillfkrplnyeaelraataaaq

SCOPe Domain Coordinates for d1qb3a_:

Click to download the PDB-style file with coordinates for d1qb3a_.
(The format of our PDB-style files is described here.)

Timeline for d1qb3a_: