Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) |
Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
Protein cks1 [55641] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55642] (1 PDB entry) |
Domain d1qb3a_: 1qb3 A: [40680] |
PDB Entry: 1qb3 (more details), 3 Å
SCOPe Domain Sequences for d1qb3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qb3a_ d.97.1.1 (A:) cks1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} hafqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgt lriltedewrglgitqslgwehyechapephillfkrplnyeaelraataaaq
Timeline for d1qb3a_: