SCOPe 2.07: Domain d6p5za2: 6p5z A:114-215

Lineage for d6p5za2 (6p5z A:114-215)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily)
   2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix

4. Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (2 families)

5. Family e.37.1.1: Siroheme synthase middle domains-like [75616] (2 proteins)

6. Protein Siroheme synthase CysG, domains 2 and 3 [103403] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [103404] (5 PDB entries)

8. Domain d6p5za2: 6p5z A:114-215 [406510]
   Other proteins in same PDB: d6p5za1, d6p5za3, d6p5zb1, d6p5zb3
   automated match to d1pjta3
   complexed with cl, f0x, sah

Details for d6p5za2

PDB Entry: 6p5z, 2.26 Å

PDB Description: cobalt-sirohydrochlorin-bound s. typhimurium siroheme synthase

PDB Compounds: (A:) Siroheme synthase

SCOPe Domain Sequences for d6p5za2:

Sequence; same for both SEQRES and ATOM records:

>d6p5za2 e.37.1.1 (A:114-215) Siroheme synthase CysG, domains 2 and 3 {Salmonella typhimurium [TaxId: 90371]}
psiidrsplmvavsaggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg
errrfwekffvndrlaqslanadekavnatterlfsepldhr

Timeline for d6p5za2:

• d6p5za2 is new in SCOPe 2.07-stable
  
• d6p5za2 appears in the current release, SCOPe 2.08