SCOPe 2.07: Domain d7lmrb1: 7lmr B:1-107

Lineage for d7lmrb1 (7lmr B:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d7lmrb1: 7lmr B:1-107 [405530]
   automated match to d1lila1
   complexed with 9zx, po4

Details for d7lmrb1

PDB Entry: 7lmr, 2.09 Å

PDB Description: structure of full-length human lambda-6a light chain jto in complex with stabilizer 63 [4-methyl-3-(morpholinomethyl)-7-(2- phenylpropoxy)-2h-chromen-2-one]

PDB Compounds: (B:) JTO light chain

SCOPe Domain Sequences for d7lmrb1:

Sequence; same for both SEQRES and ATOM records:

>d7lmrb1 b.1.1.0 (B:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmlnqphsvsespgktvtisctrssgnidsnyvqwyqqrpgsapitviyednqrpsgvp
drfagsidrssnsasltisglktedeadyycqsydarnvvfgggtrltvlg

Timeline for d7lmrb1:

• d7lmrb1 is new in SCOPe 2.07-stable
  
• d7lmrb1 appears in the current release, SCOPe 2.08