Lineage for d7dana2 (7dan A:115-293)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2378329Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families) (S)
    automatically mapped to Pfam PF08527
  5. 2378350Family b.2.9.0: automated matches [272207] (1 protein)
    not a true family
  6. 2378351Protein automated matches [272208] (1 species)
    not a true protein
  7. 2378352Species Human (Homo sapiens) [TaxId:9606] [272209] (26 PDB entries)
  8. 2378377Domain d7dana2: 7dan A:115-293 [405027]
    Other proteins in same PDB: d7dana1, d7dana3, d7danb1, d7danb3, d7danc1, d7danc3
    automated match to d2dexx1
    complexed with ca, cl, edo, gol

Details for d7dana2

PDB Entry: 7dan (more details), 3.1 Å

PDB Description: structure of the ca2+-bound wild-type peptidylarginine deiminase type iii (pad3)
PDB Compounds: (A:) Protein-arginine deiminase type-3

SCOPe Domain Sequences for d7dana2:

Sequence, based on SEQRES records: (download)

>d7dana2 b.2.9.0 (A:115-293) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdisldcdlncegrqdrnfvdkrqwvwgpsgyggillvncdrddpscdvqdncdqhvhcl
qdledmsvmvlrtqgpaalfddhklvlhtssydakraqvfhicgpedvceayrhvlgqdk
vsyevprlhgdeerffveglsfpdagftglisfhvtllddsnedfsaspiftdtvvfrv

Sequence, based on observed residues (ATOM records): (download)

>d7dana2 b.2.9.0 (A:115-293) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdisldcdlncedkrqwvwgpsgyggillvncdrddpscdqdncdqhvhclqdledmsvm
vlrtqgpaalfddhklvlhtssydakraqvfhicgpedvceayrhvlgqdkvsyevprlh
gdeerffveglsfpdagftglisfhvtllddsnaspiftdtvvfrv

SCOPe Domain Coordinates for d7dana2:

Click to download the PDB-style file with coordinates for d7dana2.
(The format of our PDB-style files is described here.)

Timeline for d7dana2: