SCOPe 2.07: Domain d7d0ma2: 7d0m A:206-495

Lineage for d7d0ma2 (7d0m A:206-495)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
   multihelical; consists of two all-alpha subdomains

4. Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families)
   automatically mapped to Pfam PF03441

5. Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 proteins)

6. Protein automated matches [228408] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [228409] (17 PDB entries)

8. Domain d7d0ma2: 7d0m A:206-495 [404952]
   Other proteins in same PDB: d7d0ma1
   automated match to d4i6ga2
   complexed with peg, pg4

Details for d7d0ma2

PDB Entry: 7d0m, 1.95 Å

PDB Description: crystal structure of mouse cry1 with bound cryoprotectant

PDB Compounds: (A:) Cryptochrome-1

SCOPe Domain Sequences for d7d0ma2:

Sequence; same for both SEQRES and ATOM records:

>d7d0ma2 a.99.1.1 (A:206-495) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ssavwpggetealtrlerhlerkawvanferprmnansllasptglspylrfgclscrlf
yfkltdlykkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqipwdknpe
alakwaegrtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeell
ldadwsinagswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpakyiy
dpwnapegiqkvakcligvnypkpmvnhaeasrlniermkqiyqqlsryr

Timeline for d7d0ma2:

• d7d0ma2 is new in SCOPe 2.07-stable
  
• d7d0ma2 appears in the current release, SCOPe 2.08