Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Isatis tinctoria [TaxId:161756] [404771] (7 PDB entries) |
Domain d7cs8e_: 7cs8 E: [404863] automated match to d1qyca_ complexed with go6, ndp |
PDB Entry: 7cs8 (more details), 2.6 Å
SCOPe Domain Sequences for d7cs8e_:
Sequence, based on SEQRES records: (download)
>d7cs8e_ c.2.1.0 (E:) automated matches {Isatis tinctoria [TaxId: 161756]} ektrvlvvggtgtmgrrivraclaeghetyvlqqpetrvdiekvqllysykrlgarliea sfsdhqslvsavkqvdivvaamsgvhfrshsilvqlklveaikeagnikrflpsefgmdp srmghamppgretfdqklevrnaieaagiphtyvvgacfaayfagnlsqmgtlippkkkv niygdgnvkvvyvdeddiaeytaktlddprtinktvyvrptenvltqmelvqiwekltgk elektnisandfladiedkeiphqaglghfyhifyegcltdhevgddeeasklypdvkyt rmdeylkifl
>d7cs8e_ c.2.1.0 (E:) automated matches {Isatis tinctoria [TaxId: 161756]} ektrvlvvggtgtmgrrivraclaeghetyvlqqpetrvdiekvqllysykrlgarliea sfsdhqslvsavkqvdivvaamsgshsilvqlklveaikeagnikrflpsefgmdpsrmg dqklevrnaieaagiphtyvvgacfaayfagnlsqmgtlippkkkvniygdgnvkvvyvd eddiaeytaktlddprtinktvyvrptenvltqmelvqiwekltgkelektnisandfla dqaglghfyhifyegcltdhevgddeeasklypdvkytrmdeylkifl
Timeline for d7cs8e_: