SCOP 1.75: Domain d1fyra_: 1fyr A:

Lineage for d1fyra_ (1fyr A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (34 proteins)
   Pfam PF00017

6. Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55564] (20 PDB entries)

8. Domain d1fyra_: 1fyr A: [40469]

Details for d1fyra_

PDB Entry: 1fyr, 2.4 Å

PDB Description: dimer formation through domain swapping in the crystal structure of the grb2-sh2 ac-pyvnv complex

PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOP Domain Sequences for d1fyra_:

Sequence; same for both SEQRES and ATOM records:

>d1fyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
hpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagk
yflwvvkfnslnelvdyhrstsvsrnqqiflrdie

Timeline for d1fyra_:

• d1fyra_ first appeared (with stable ids) in SCOP 1.55
  
• d1fyra_ appears in SCOP 1.73
  
• d1fyra_ appears in SCOPe 2.01
  
• d1fyra_ appears in the current release, SCOPe 2.08