Lineage for d1bm2a_ (1bm2 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332255Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 332256Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 332257Family d.93.1.1: SH2 domain [55551] (25 proteins)
  6. 332339Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 332340Species Human (Homo sapiens) [TaxId:9606] [55564] (13 PDB entries)
  8. 332344Domain d1bm2a_: 1bm2 A: [40467]
    complexed with ace, slz

Details for d1bm2a_

PDB Entry: 1bm2 (more details), 2.1 Å

PDB Description: grb2-sh2 domain in complex with cyclo-[n-alpha-acetyl-l-thi alysyl-o- phosphotyrosyl-valyl-asparagyl-valyl-prolyl] (pkf273-791)

SCOP Domain Sequences for d1bm2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bm2a_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens)}
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

SCOP Domain Coordinates for d1bm2a_:

Click to download the PDB-style file with coordinates for d1bm2a_.
(The format of our PDB-style files is described here.)

Timeline for d1bm2a_: