SCOPe 2.07: Domain d6yyfb_: 6yyf B:

Lineage for d6yyfb_ (6yyf B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Bruton's tyrosine kinase [50738] (1 species)
   contains Btk zinc-binding motif

7. Species Human (Homo sapiens) [TaxId:9606] [50739] (10 PDB entries)

8. Domain d6yyfb_: 6yyf B: [404241]
   automated match to d1btka_
   complexed with 3is, mg, zn; mutant

Details for d6yyfb_

PDB Entry: 6yyf, 1.93 Å

PDB Description: crystal structure of 5-chloroindoline-2,3-dione covalently bound to the ph domain of bruton's tyrosine kinase mutant r28c

PDB Compounds: (B:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d6yyfb_:

Sequence, based on SEQRES records:

>d6yyfb_ b.55.1.1 (B:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
aavilesiflkrsqqkkktsplnfkkclflltvhklsyyeydfergrrgskkgsidveki
tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen

Sequence, based on observed residues (ATOM records):

>d6yyfb_ b.55.1.1 (B:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
aavilesiflkrsqnfkkclflltvhklsyyeydfergrrgskkgsidvekitcvetvvp
eknppperqipeqisiierfpypfqvvydegplyvfspteelrkrwihqlknvirynsdl
vqkyhpcfwidgqylccsqtaknamgcqilen

Timeline for d6yyfb_:

• d6yyfb_ is new in SCOPe 2.07-stable
  
• d6yyfb_ appears in the current release, SCOPe 2.08