Lineage for d6xhra_ (6xhr A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2506852Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2506853Protein automated matches [190951] (33 species)
    not a true protein
  7. 2506983Species Staphylococcus aureus [TaxId:1280] [404012] (5 PDB entries)
  8. 2506992Domain d6xhra_: 6xhr A: [404028]
    automated match to d2vsha_
    complexed with scn

Details for d6xhra_

PDB Entry: 6xhr (more details), 2.1 Å

PDB Description: crystal structure of s. aureus tari (space group p1211)
PDB Compounds: (A:) Ribitol-5-phosphate cytidylyltransferase 1

SCOPe Domain Sequences for d6xhra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xhra_ c.68.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
mkyagilaggigsrmgnvplpkqfldldnkpilihtlekfilindfekiiiatpqqwmth
tkdtlrkfkisderieviqggsdrndtimnivkhiestngindddvivthdavrpflthr
iikeniqaaleygavdtvidaidtivtskdnqtidaipvrnemyqgqtpqsfninllkes
yaqlsdeqksilsdackiivetnkpvrlvkgelynikvttpydlkvanaiirggia

SCOPe Domain Coordinates for d6xhra_:

Click to download the PDB-style file with coordinates for d6xhra_.
(The format of our PDB-style files is described here.)

Timeline for d6xhra_: