Lineage for d7nhqx_ (7nhq X:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026852Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 3026853Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 3026857Protein automated matches [267680] (2 species)
    not a true protein
  7. 3026858Species Thermosynechococcus elongatus [TaxId:197221] [311275] (12 PDB entries)
  8. 3026865Domain d7nhqx_: 7nhq X: [403857]
    Other proteins in same PDB: d7nhqa_, d7nhqb_, d7nhqc_, d7nhqd_, d7nhqe_, d7nhqf_, d7nhqh_, d7nhqi_, d7nhqk_, d7nhql_, d7nhqm_, d7nhqt_, d7nhqz_
    automated match to d5v2cx_
    complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhqx_

PDB Entry: 7nhq (more details), 2.68 Å

PDB Description: structure of psii-i prime (psii with psb28, and psb34)
PDB Compounds: (X:) Photosystem II reaction center X protein

SCOPe Domain Sequences for d7nhqx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nhqx_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
titpslkgffigllsgavvlgltfavliaisqidk

SCOPe Domain Coordinates for d7nhqx_:

Click to download the PDB-style file with coordinates for d7nhqx_.
(The format of our PDB-style files is described here.)

Timeline for d7nhqx_: