| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) ![]() automatically mapped to Pfam PF02419 |
| Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
| Protein Photosystem II reaction center protein L, PsbL [161019] (2 species) |
| Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries) |
| Domain d7nhql_: 7nhq L: [403810] Other proteins in same PDB: d7nhqa_, d7nhqb_, d7nhqc_, d7nhqd_, d7nhqe_, d7nhqf_, d7nhqh_, d7nhqi_, d7nhqk_, d7nhqm_, d7nhqt_, d7nhqx_, d7nhqz_ automated match to d3a0hl_ complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nhq (more details), 2.68 Å
SCOPe Domain Sequences for d7nhql_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhql_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d7nhql_: