Lineage for d7nhqm_ (7nhq M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026592Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 3026593Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 3026594Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)
  7. 3026595Species Thermosynechococcus elongatus [TaxId:146786] [161036] (11 PDB entries)
    Uniprot Q8DHA7 1-36
  8. 3026600Domain d7nhqm_: 7nhq M: [403760]
    Other proteins in same PDB: d7nhqa_, d7nhqb_, d7nhqc_, d7nhqd_, d7nhqe_, d7nhqf_, d7nhqh_, d7nhqi_, d7nhqk_, d7nhql_, d7nhqt_, d7nhqx_, d7nhqz_
    automated match to d2axtm1
    complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhqm_

PDB Entry: 7nhq (more details), 2.68 Å

PDB Description: structure of psii-i prime (psii with psb28, and psb34)
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d7nhqm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nhqm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

SCOPe Domain Coordinates for d7nhqm_:

Click to download the PDB-style file with coordinates for d7nhqm_.
(The format of our PDB-style files is described here.)

Timeline for d7nhqm_: