| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) ![]() automatically mapped to Pfam PF05151 |
| Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
| Protein Photosystem II reaction center protein M, PsbM [161035] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161036] (11 PDB entries) Uniprot Q8DHA7 1-36 |
| Domain d7nhqm_: 7nhq M: [403760] Other proteins in same PDB: d7nhqa_, d7nhqb_, d7nhqc_, d7nhqd_, d7nhqe_, d7nhqf_, d7nhqh_, d7nhqi_, d7nhqk_, d7nhql_, d7nhqt_, d7nhqx_, d7nhqz_ automated match to d2axtm1 complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nhq (more details), 2.68 Å
SCOPe Domain Sequences for d7nhqm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhqm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk
Timeline for d7nhqm_: