SCOPe 2.07: Domain d7ly0h_: 7ly0 H:

Lineage for d7ly0h_ (7ly0 H:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d7ly0h_: 7ly0 H: [403705]
   Other proteins in same PDB: d7ly0l_
   automated match to d5gs1b_
   complexed with fuc, man, nag

Details for d7ly0h_

PDB Entry: 7ly0, 2.6 Å

PDB Description: sars-cov-2 s/s2m11/s2m28 local refinement

PDB Compounds: (H:) S2M28 Fab Heavy Chain variable region

SCOPe Domain Sequences for d7ly0h_:

Sequence; same for both SEQRES and ATOM records:

>d7ly0h_ b.1.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesgggvvqpgrslrlscaasgftfssygmhwvrqapgkglewvtviwydgsnryya
dsvkgrftisrdnskntlylqmdslraedtavyycaravagewyfdywgqgtlvtvs

Timeline for d7ly0h_:

• d7ly0h_ is new in SCOPe 2.07-stable
  
• d7ly0h_ appears in the current release, SCOPe 2.08