Lineage for d1bqob_ (1bqo B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2571173Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 2571174Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)
  8. 2571210Domain d1bqob_: 1bqo B: [40364]
    complexed with ca, n25, zn

Details for d1bqob_

PDB Entry: 1bqo (more details), 2.3 Å

PDB Description: discovery of potent, achiral matrix metalloproteinase inhibitors
PDB Compounds: (B:) stromelysin-1

SCOPe Domain Sequences for d1bqob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqob_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet

SCOPe Domain Coordinates for d1bqob_:

Click to download the PDB-style file with coordinates for d1bqob_.
(The format of our PDB-style files is described here.)

Timeline for d1bqob_: