Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.0: automated matches [191435] (1 protein) not a true family |
Protein automated matches [190626] (12 species) not a true protein |
Species Escherichia coli [TaxId:562] [403527] (1 PDB entry) |
Domain d7lola_: 7lol A: [403528] automated match to d1gq6a_ complexed with ag2, mn, trs, ure |
PDB Entry: 7lol (more details), 1.8 Å
SCOPe Domain Sequences for d7lola_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lola_ c.42.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]} slvsnafgflrlpmnfqpydsdadwvitgvpfdmatsgraggrhgpaairqvstnlaweh nrfpwnfdmrerlnvvdcgdlvyafgdaremseklqahaekllaagkrmlsfggdhfvtl pllrahakhfgkmalvhfdahtdtyangcefdhgtmfytapkeglidpnhsvqigirtef dkdngftvldacqvndrsvddviaqvkqivgdmpvyltfdidcldpafapgtgtpviggl tsdraiklvrglkdlnivgmdvvevapaydqseitalaaatlalemlyiqaakk
Timeline for d7lola_: