Lineage for d7lola_ (7lol A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481831Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2481832Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2482296Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 2482297Protein automated matches [190626] (12 species)
    not a true protein
  7. 2482353Species Escherichia coli [TaxId:562] [403527] (1 PDB entry)
  8. 2482354Domain d7lola_: 7lol A: [403528]
    automated match to d1gq6a_
    complexed with ag2, mn, trs, ure

Details for d7lola_

PDB Entry: 7lol (more details), 1.8 Å

PDB Description: the structure of agmatinase from e. coli at 1.8 a displaying urea and agmatine
PDB Compounds: (A:) agmatinase

SCOPe Domain Sequences for d7lola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lola_ c.42.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
slvsnafgflrlpmnfqpydsdadwvitgvpfdmatsgraggrhgpaairqvstnlaweh
nrfpwnfdmrerlnvvdcgdlvyafgdaremseklqahaekllaagkrmlsfggdhfvtl
pllrahakhfgkmalvhfdahtdtyangcefdhgtmfytapkeglidpnhsvqigirtef
dkdngftvldacqvndrsvddviaqvkqivgdmpvyltfdidcldpafapgtgtpviggl
tsdraiklvrglkdlnivgmdvvevapaydqseitalaaatlalemlyiqaakk

SCOPe Domain Coordinates for d7lola_:

Click to download the PDB-style file with coordinates for d7lola_.
(The format of our PDB-style files is described here.)

Timeline for d7lola_: