SCOPe 2.08: Domain d7cjjz_: 7cjj Z:

Lineage for d7cjjz_ (7cjj Z:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.5: PsbZ-like [161055] (2 families)
   automatically mapped to Pfam PF01737

5. Family f.17.5.1: PsbZ-like [161056] (1 protein)
   Pfam PF01737; Ycf9

6. Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries)

8. Domain d7cjjz_: 7cjj Z: [403188]
   Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjf_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjl_, d7cjjm_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjv_, d7cjjx_
   automated match to d3a0hz_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjjz_

PDB Entry: 7cjj, 2.4 Å

PDB Description: photosystem ii structure in the s2 state

PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d7cjjz_:

Sequence; same for both SEQRES and ATOM records:

>d7cjjz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

Timeline for d7cjjz_:

• d7cjjz_ first appeared in SCOPe 2.07