SCOPe 2.08: Domain d7cjjx_: 7cjj x:

Lineage for d7cjjx_ (7cjj x:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family)
   Pfam PF06596

5. Family f.23.40.1: PsbX-like [267615] (2 proteins)

6. Protein automated matches [267680] (2 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (27 PDB entries)

8. Domain d7cjjx_: 7cjj x: [403103]
   Other proteins in same PDB: d7cjja_, d7cjjb_, d7cjjc_, d7cjjd_, d7cjje_, d7cjjf_, d7cjjh_, d7cjji_, d7cjjj_, d7cjjk_, d7cjjl_, d7cjjm_, d7cjjo_, d7cjjt_, d7cjju_, d7cjjv_, d7cjjz_
   automated match to d4il6x_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjjx_

PDB Entry: 7cjj, 2.4 Å

PDB Description: photosystem ii structure in the s2 state

PDB Compounds: (x:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d7cjjx_:

Sequence; same for both SEQRES and ATOM records:

>d7cjjx_ f.23.40.1 (x:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

Timeline for d7cjjx_:

• d7cjjx_ first appeared in SCOPe 2.07