Lineage for d7byeb_ (7bye B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393878Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2393985Family b.34.6.0: automated matches [328522] (1 protein)
    not a true family
  6. 2393986Protein automated matches [328523] (5 species)
    not a true protein
  7. 2394008Species Klebsiella pneumoniae [TaxId:272620] [403022] (1 PDB entry)
  8. 2394009Domain d7byeb_: 7bye B: [403067]
    automated match to d5ck9a_
    complexed with po4

Details for d7byeb_

PDB Entry: 7bye (more details), 2.3 Å

PDB Description: toxin-antitoxin complex from klebsiella pneumoniae
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d7byeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7byeb_ b.34.6.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
ycpargdvilldfnpqsgheqagkrpalvvsddlfnqvtgfavvcpitnqikgypfevpv
dgttkttgviladqvksldwkaraartvdsvsgetvttvvdmvskiik

SCOPe Domain Coordinates for d7byeb_:

Click to download the PDB-style file with coordinates for d7byeb_.
(The format of our PDB-style files is described here.)

Timeline for d7byeb_: