SCOPe 2.08: Domain d1smpa2: 1smp A:4-246

Lineage for d1smpa2 (1smp A:4-246)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
   characteristic HEXXHXXGXXH motif and Met located near C-terminus

6. Protein Metalloprotease [55509] (4 species)
   the rest of protein is all-beta sandwich containing a parallel beta-helix

7. Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries)
   Serralysin

8. Domain d1smpa2: 1smp A:4-246 [40303]
   Other proteins in same PDB: d1smpa1, d1smpi_
   complexed with ca, zn

Details for d1smpa2

PDB Entry: 1smp, 2.3 Å

PDB Description: crystal structure of a complex between serratia marcescens metallo-protease and an inhibitor from erwinia chrysanthemi

PDB Compounds: (A:) serratia metallo proteinase

SCOPe Domain Sequences for d1smpa2:

Sequence; same for both SEQRES and ATOM records:

>d1smpa2 d.92.1.6 (A:4-246) Metalloprotease {Serratia marcescens [TaxId: 615]}
tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp
dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd
rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg
lshpgdynagegnptyndvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq
hly

Timeline for d1smpa2:

• d1smpa2 first appeared (with stable ids) in SCOP 1.55
  
• d1smpa2 appears in SCOPe 2.07