Lineage for d1sat_2 (1sat 4-246)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) 
Family d.92.1.6: Metallo protease, catalytic (N-terminal) domain [55508] (1 protein) Protein Metallo protease, catalytic (N-terminal) domain [55509] (2 species) 
Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries) 
Domain d1sat_2: 1sat 4-246 [40300]
Other proteins in same PDB: d1sat_1
Details for d1sat_2
PDB Entry: 1sat (more details), 1.75 Å
PDB Description: crystal structure of the 50 kda metallo protease from s. marcescens
SCOP Domain Sequences for d1sat_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sat_2 d.92.1.6 (4-246) Metallo protease, catalytic (N-terminal) domain {Serratia marcescens}
tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp
dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd
rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg
lshpgdynagegdptyadvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq
hly
SCOP Domain Coordinates for d1sat_2:
Click to download the PDB-style file with coordinates for d1sat_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sat_2:
- d1sat_2 appears in SCOP 1.57
- d1sat_2 appears in the current release, SCOPe 2.08, called d1sata2
View in 3D
