PDB entry 1sat

View 1sat on RCSB PDB site
Description: crystal structure of the 50 kda metallo protease from s. marcescens
Deposited on 1994-07-04, released 1995-07-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.188
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sat_ (-)
    tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp
    dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd
    rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg
    lshpgdynagegdptyadvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq
    hlyganlstrtgdtvygfnsntgrdflsttsnsqkvifaawdaggndtfdfsgytanqri
    nlneksfsdvgglkgnvsiaagvtienaiggsgndvivgnaannvlkggagndvlfgggg
    adelwggagkdifvfsaasdsapgasdwirdfqkgidkidlsffdkeansssfihfvdhf
    sgtageallsynassnvtdlsvnigghaapdflvkivgqvdvatdfiv