SCOPe 2.07: Domain d7akma_: 7akm A:

Lineage for d7akma_ (7akm A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cell cycle checkpoint kinase chk1 [64404] (1 species)
   CaMK group; CAMKL subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [64405] (87 PDB entries)

8. Domain d7akma_: 7akm A: [402975]
   automated match to d5oora_
   complexed with ags, cit, edo, mg

Details for d7akma_

PDB Entry: 7akm, 1.93 Å

PDB Description: crystal structure of chk1 kinase domain in complex with atpys

PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOPe Domain Sequences for d7akma_:

Sequence; same for both SEQRES and ATOM records:

>d7akma_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwrlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
lhkilvenpsaritipdikkdrwynkplkk

Timeline for d7akma_:

• d7akma_ is new in SCOPe 2.07-stable
  
• d7akma_ appears in the current release, SCOPe 2.08