SCOPe 2.07: Domain d6z3de_: 6z3d E:

Lineage for d6z3de_ (6z3d E:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [355187] (7 PDB entries)

8. Domain d6z3de_: 6z3d E: [402881]
   automated match to d1iera_
   complexed with act

Details for d6z3de_

PDB Entry: 6z3d, 1.7 Å

PDB Description: l-ferritinmsa

PDB Compounds: (E:) Ferritin

SCOPe Domain Sequences for d6z3de_:

Sequence, based on SEQRES records:

>d6z3de_ a.25.1.1 (E:) automated matches {Mus musculus [TaxId: 10090]}
mtsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekr
egaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsa
radphlcdfleshyldkevklikkmgnhltnlrrvagpqpaqtgapqgslgeylferltl
kh

Sequence, based on observed residues (ATOM records):

>d6z3de_ a.25.1.1 (E:) automated matches {Mus musculus [TaxId: 10090]}
mtsqirqnysteveaavnrlvnlhlrasytylslgfffdrddvalegvghffrelaeekr
egaerllefqndrggralfqdvqkpsqdewgktqeameaalameknlnqalldlhalgsa
radphlcdfleshyldkevklikkmgnhltnlrrvaslgeylferltlkh

Timeline for d6z3de_:

• d6z3de_ is new in SCOPe 2.07-stable
  
• d6z3de_ appears in the current release, SCOPe 2.08