Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) common fold is elaborated with additional secondary structures |
Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins) |
Protein automated matches [194683] (3 species) not a true protein |
Species Escherichia coli [TaxId:83333] [402833] (1 PDB entry) |
Domain d6yeva_: 6yev A: [402868] Other proteins in same PDB: d6yeve_, d6yevf_, d6yevg_ automated match to d1ff3a_ complexed with na |
PDB Entry: 6yev (more details), 2.94 Å
SCOPe Domain Sequences for d6yeva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yeva_ d.58.28.1 (A:) automated matches {Escherichia coli [TaxId: 83333]} fdkkhlvspadalpgrntpmpvatlhavnghsmtnvpdgmeiaifamgafwgverlfwql pgvystaagytggytpnptyrevasgdtghaeavrivydpsvisyeqllqvfwenhdpaq gmrqgndhgtqyrsaiypltpeqdaaaraslerfqaamlaadddrhitteianatpfyya eddhqqylhknpygyagiggigvclppea
Timeline for d6yeva_: