Lineage for d6yeva_ (6yev A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561596Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2561597Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)
  6. 2561613Protein automated matches [194683] (3 species)
    not a true protein
  7. 2561616Species Escherichia coli [TaxId:83333] [402833] (1 PDB entry)
  8. 2561617Domain d6yeva_: 6yev A: [402868]
    Other proteins in same PDB: d6yeve_, d6yevf_, d6yevg_
    automated match to d1ff3a_
    complexed with na

Details for d6yeva_

PDB Entry: 6yev (more details), 2.94 Å

PDB Description: crystal structure of msra c206 and trx c35s complex from escherichia coli
PDB Compounds: (A:) Peptide methionine sulfoxide reductase msrA

SCOPe Domain Sequences for d6yeva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yeva_ d.58.28.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
fdkkhlvspadalpgrntpmpvatlhavnghsmtnvpdgmeiaifamgafwgverlfwql
pgvystaagytggytpnptyrevasgdtghaeavrivydpsvisyeqllqvfwenhdpaq
gmrqgndhgtqyrsaiypltpeqdaaaraslerfqaamlaadddrhitteianatpfyya
eddhqqylhknpygyagiggigvclppea

SCOPe Domain Coordinates for d6yeva_:

Click to download the PDB-style file with coordinates for d6yeva_.
(The format of our PDB-style files is described here.)

Timeline for d6yeva_: