Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein automated matches [190670] (7 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:1718] [402794] (1 PDB entry) |
Domain d6yc7a_: 6yc7 A: [402798] automated match to d2eg2a_ complexed with a5o, adp, amp |
PDB Entry: 6yc7 (more details), 1.8 Å
SCOPe Domain Sequences for d6yc7a_:
Sequence, based on SEQRES records: (download)
>d6yc7a_ d.58.5.1 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]} mklitaivkpftltdikdaleqagvqgmtvtetqgfgqqkghtevyrgaeyavdfvpkvk ieviisdaqaeeviniivetartgkvgdgkvwmtnieelvrvrtgergeaal
>d6yc7a_ d.58.5.1 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]} mklitaivkpftltdikdaleqagvqgmtvtetqgftevyraeyavdfvpkvkieviisd aqaeeviniivetartgkvgdgkvwmtnieelvrvrtgergeaal
Timeline for d6yc7a_: