Lineage for d6wkua3 (6wku A:230-336)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608350Domain d6wkua3: 6wku A:230-336 [402640]
    automated match to d1t61a1
    complexed with 1pe, cl, edo, p6g, pe8, peg, pg4, pge

Details for d6wkua3

PDB Entry: 6wku (more details), 1.76 Å

PDB Description: twelve chloride ions drive assembly of human alpha345 collagen iv nc1 domain
PDB Compounds: (A:) Collagen alpha-3(IV) chain,Collagen alpha-4(IV) chain,Collagen alpha-5(IV) chain

SCOPe Domain Sequences for d6wkua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wkua3 d.169.1.0 (A:230-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fllvlhsqtdqeptcplgmprlwtgysllylegqekahnqdlglagsclpvfstlpfayc
nihqvchyaqrndrsywlasaaplpmmplseeairpyvsrcavceap

SCOPe Domain Coordinates for d6wkua3:

Click to download the PDB-style file with coordinates for d6wkua3.
(The format of our PDB-style files is described here.)

Timeline for d6wkua3: