SCOPe 2.07: Domain d6syab_: 6sya B:

Lineage for d6syab_ (6sya B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [196706] (43 PDB entries)

8. Domain d6syab_: 6sya B: [402593]
   automated match to d4j7aa_
   complexed with gol, ly8

Details for d6syab_

PDB Entry: 6sya, 2.27 Å

PDB Description: structure of s192a-ester-hydrolase eh3 from the metagenome of marine sediments at milazzo harbor (sicily, italy) complexed with methyl (2r)-2-phenylpropanoate

PDB Compounds: (B:) esterase

SCOPe Domain Sequences for d6syab_:

Sequence; same for both SEQRES and ATOM records:

>d6syab_ c.69.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
iaddvrmdprlkamlaafpmmeqqtfqtreeqvanantpeataareqlkmmmdmmdseef
apsdnldistreftsspdgnaikiqfirpkgkqkvpcvyyihgggmmimsafygnyrawg
kmianngvavamvdfrnclspssapevapfpaglndcvsglkwvsenadelsidknkiii
ageagggnltlatglklkqdgnidlvkglyalcpyiagkwpqdrfpsssenngimielhn
nqgalaygieqleaenplawpsfasaedmqglpptvinvnecdplrdegidfyrrlmaag
vparcrqvmgtchagdmfvavipdvsadtaadiartakgg

Timeline for d6syab_:

• d6syab_ is new in SCOPe 2.07-stable
  
• d6syab_ appears in the current release, SCOPe 2.08