Lineage for d7loza3 (7loz A:232-383)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582827Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)
  6. 2582946Protein automated matches [402219] (1 species)
    not a true protein
  7. 2582947Species Escherichia coli [TaxId:1268998] [402220] (5 PDB entries)
  8. 2582954Domain d7loza3: 7loz A:232-383 [402574]
    Other proteins in same PDB: d7loza1, d7loza2, d7lozb1, d7lozb2, d7lozb4
    automated match to d1mxaa3
    complexed with edo, mg, po4, pop

Details for d7loza3

PDB Entry: 7loz (more details), 2.25 Å

PDB Description: s-adenosylmethionine synthetase
PDB Compounds: (A:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d7loza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7loza3 d.130.1.1 (A:232-383) automated matches {Escherichia coli [TaxId: 1268998]}
iggpmgdcgltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagla
drceiqvsyaigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiy
ketaayghfgrehfpwektdkaqllrdaaglk

SCOPe Domain Coordinates for d7loza3:

Click to download the PDB-style file with coordinates for d7loza3.
(The format of our PDB-style files is described here.)

Timeline for d7loza3: