Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily) core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542 |
Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) automatically mapped to Pfam PF09408 |
Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein) part of PfamB PB000266 |
Protein Spike protein S1 [143589] (4 species) |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382292] (92 PDB entries) |
Domain d7nxbe_: 7nxb E: [402562] Other proteins in same PDB: d7nxbb1, d7nxbb2, d7nxbl1, d7nxbl2 automated match to d2dd8s1 complexed with gol, nag, peg, so4 |
PDB Entry: 7nxb (more details), 2.67 Å
SCOPe Domain Sequences for d7nxbe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nxbe_ d.318.1.1 (E:) Spike protein S1 {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} nlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcft nvyadsfvirgdevrqiapgqtgtiadynyklpddftgcviawnsnnldskvggnynyly rlfrksnlkpferdisteiyqagstpcngvkgfncyfplqsygfqptygvgyqpyrvvvl sfellhapatvcg
Timeline for d7nxbe_:
View in 3D Domains from other chains: (mouse over for more information) d7nxbb1, d7nxbb2, d7nxbl1, d7nxbl2 |