Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188649] (68 PDB entries) |
Domain d7l0ff_: 7l0f F: [402483] Other proteins in same PDB: d7l0fa_, d7l0fe_, d7l0fg_, d7l0fl_ automated match to d3uyod_ complexed with gsp, mg |
PDB Entry: 7l0f (more details), 1.98 Å
SCOPe Domain Sequences for d7l0ff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7l0ff_ b.1.2.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} svptklevvaatptslliswdapavtvffyiiaygetghgvgafqafrvpgskstatisg lkpgvdytitvyargyskqgpykpspisinyrt
Timeline for d7l0ff_: