Lineage for d6m6mb_ (6m6m B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441491Species Kribbella flavida [TaxId:479435] [402436] (2 PDB entries)
  8. 2441495Domain d6m6mb_: 6m6m B: [402437]
    Other proteins in same PDB: d6m6ma2
    automated match to d2e3za_
    complexed with trs; mutant

Details for d6m6mb_

PDB Entry: 6m6m (more details), 2.07 Å

PDB Description: the crystal structure of glycosidase mutant
PDB Compounds: (B:) Beta-glucosidase

SCOPe Domain Sequences for d6m6mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m6mb_ c.1.8.0 (B:) automated matches {Kribbella flavida [TaxId: 479435]}
mvelsplrqdfvwgtatsayqiegavaddgrlpsiwdtfcrvpgaidngdtgdvacdsyh
rwpedlallkqlgvdayrfsiawprviptgsgavntagldyydrvvddllaegikpfvtl
yhwdlpqalqdlggwdnrdtayrfaeyaavvgaklgdrvrdwvtlneplcsawighwegr
mapgitdpaiavrasynlllahglgvaalrdacpeppavglvvnlsgcepasqspedira
ariadghfnrwwldptsgrgfpadmvetygvelperpgdleiiaaptdfiglnyyfrqii
eadgsvpvlgfsqvpgpnaehtmidwevhpagleelilrlakeygaekiyvtengsawvd
qpdaefavddpdrtayleehlaacvraveqgaplagyfawslmdnfewargyaprfglay
vdyptgtrvmktsgkryadlirghre

SCOPe Domain Coordinates for d6m6mb_:

Click to download the PDB-style file with coordinates for d6m6mb_.
(The format of our PDB-style files is described here.)

Timeline for d6m6mb_: