Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (125 species) not a true protein |
Species Kribbella flavida [TaxId:479435] [402436] (2 PDB entries) |
Domain d6m6mb_: 6m6m B: [402437] Other proteins in same PDB: d6m6ma2 automated match to d2e3za_ complexed with trs; mutant |
PDB Entry: 6m6m (more details), 2.07 Å
SCOPe Domain Sequences for d6m6mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m6mb_ c.1.8.0 (B:) automated matches {Kribbella flavida [TaxId: 479435]} mvelsplrqdfvwgtatsayqiegavaddgrlpsiwdtfcrvpgaidngdtgdvacdsyh rwpedlallkqlgvdayrfsiawprviptgsgavntagldyydrvvddllaegikpfvtl yhwdlpqalqdlggwdnrdtayrfaeyaavvgaklgdrvrdwvtlneplcsawighwegr mapgitdpaiavrasynlllahglgvaalrdacpeppavglvvnlsgcepasqspedira ariadghfnrwwldptsgrgfpadmvetygvelperpgdleiiaaptdfiglnyyfrqii eadgsvpvlgfsqvpgpnaehtmidwevhpagleelilrlakeygaekiyvtengsawvd qpdaefavddpdrtayleehlaacvraveqgaplagyfawslmdnfewargyaprfglay vdyptgtrvmktsgkryadlirghre
Timeline for d6m6mb_: