SCOPe 2.07: Domain d6m6tb1: 6m6t B:2-497

Lineage for d6m6tb1 (6m6t B:2-497)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (33 species)
   not a true protein

7. Species Streptococcus agalactiae [TaxId:1311] [402353] (1 PDB entry)

8. Domain d6m6tb1: 6m6t B:2-497 [402359]
   Other proteins in same PDB: d6m6tb2, d6m6tc2, d6m6tc3, d6m6te2, d6m6tg2
   automated match to d1eswa_

Details for d6m6tb1

PDB Entry: 6m6t, 2.75 Å

PDB Description: amylomaltase from streptococcus agalactiae in complex with acarbose

PDB Compounds: (B:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d6m6tb1:

Sequence; same for both SEQRES and ATOM records:

>d6m6tb1 c.1.8.1 (B:2-497) automated matches {Streptococcus agalactiae [TaxId: 1311]}
kkrasgvlmhitslpgdlgigtfgreayafvdflvetdqkfwqilpltttsfgdspyqsf
savagnthlidfdlltlegfiskddyqnisfgqdpevvdyaglfekrrpvlekavknflk
eeratrmlsdflqeekwvtdfaefmaikehfgnkalqewddkaiirreeealagyrqkls
evikyhevtqyffykqwfelkeyandkgiqiigdmpiyvsadsvevwtmpelfkldrdkq
plaiagvpaddfsddgqlwgnpiynwdyhkesdfdwwiyriqsgvkmydylridhfkgfs
dyweirgdyqtandgswqpapgpelfatikeklgdlpiiaenlgyideraerllagtgfp
gmkimefgfydttgnsidiphnytentiayagthdnevingwfenltveqkayaenymrr
lpnepitetvlrtlyatvsqttitcmqdlldkpadsrmnmpntvggnwqwrmrkedlten
rkaflkeittiynrgn

Timeline for d6m6tb1:

• d6m6tb1 is new in SCOPe 2.07-stable
  
• d6m6tb1 appears in the current release, SCOPe 2.08