SCOPe 2.07: Domain d7lvua1: 7lvu A:2-111

Lineage for d7lvua1 (7lvu A:2-111)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (22 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
Domain d7lvua1: 7lvu A:2-111 [402271]
Other proteins in same PDB: d7lvua2, d7lvub2, d7lvuc2, d7lvud2
automated match to d4w81a_

Details for d7lvua1

PDB Entry: 7lvu (more details), 1.94 Å

PDB Description: structure of rsv f-directed vhh cl184

PDB Compounds: (A:) F-VHH-Cl184

SCOPe Domain Sequences for d7lvua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lvua1 b.1.1.1 (A:2-111) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasgqtfsgyvtgwfrqapgkerefvaliawsggrlyya
dsvqgrftisrdnaettvylqmnslkpedtavyycaakrggavtaaewydywgqgtqvtv

SCOPe Domain Coordinates for d7lvua1:

Click to download the PDB-style file with coordinates for d7lvua1.
(The format of our PDB-style files is described here.)

Timeline for d7lvua1: