Class b: All beta proteins [48724] (178 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries) |
Domain d7kk7b1: 7kk7 B:164-283 [402152] Other proteins in same PDB: d7kk7a2, d7kk7b2 automated match to d1u29a_ complexed with edo, gol |
PDB Entry: 7kk7 (more details), 2.8 Å
SCOPe Domain Sequences for d7kk7b1:
Sequence, based on SEQRES records: (download)
>d7kk7b1 b.55.1.0 (B:164-283) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvvvrgwlhkqdssgmrlwkrrwfvladyclfyykdsreeavlgsiplpsyvispvaped risrkysfkavhtgmraliynsstagsqaeqsgmrtyyfsadtqedmnawvramnqaaqv
>d7kk7b1 b.55.1.0 (B:164-283) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvvvrgwlhkqdssgmrlwkrrwfvladyclfyykdsreeavlgsiplpsyvispvaped risrkysfkavhrtyyfsadtqedmnawvramnqaaqv
Timeline for d7kk7b1: