SCOPe 2.07: Domain d7kk7b1: 7kk7 B:164-283

Lineage for d7kk7b1 (7kk7 B:164-283)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d7kk7b1: 7kk7 B:164-283 [402152]
   Other proteins in same PDB: d7kk7a2, d7kk7b2
   automated match to d1u29a_
   complexed with edo, gol

Details for d7kk7b1

PDB Entry: 7kk7, 2.8 Å

PDB Description: crystal structure of ligand-free plekha7 ph domain

PDB Compounds: (B:) Pleckstrin homology domain-containing family A member 7

SCOPe Domain Sequences for d7kk7b1:

Sequence, based on SEQRES records:

>d7kk7b1 b.55.1.0 (B:164-283) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvvvrgwlhkqdssgmrlwkrrwfvladyclfyykdsreeavlgsiplpsyvispvaped
risrkysfkavhtgmraliynsstagsqaeqsgmrtyyfsadtqedmnawvramnqaaqv

Sequence, based on observed residues (ATOM records):

>d7kk7b1 b.55.1.0 (B:164-283) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvvvrgwlhkqdssgmrlwkrrwfvladyclfyykdsreeavlgsiplpsyvispvaped
risrkysfkavhrtyyfsadtqedmnawvramnqaaqv

Timeline for d7kk7b1:

• d7kk7b1 is new in SCOPe 2.07-stable
  
• d7kk7b1 appears in the current release, SCOPe 2.08