Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
Protein automated matches [276200] (4 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276203] (9 PDB entries) |
Domain d7dkz4_: 7dkz 4: [402141] Other proteins in same PDB: d7dkza_, d7dkzb_, d7dkzc_, d7dkzd_, d7dkze1, d7dkze2, d7dkzf_, d7dkzj_ automated match to d5l8r4_ complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 7dkz (more details), 2.39 Å
SCOPe Domain Sequences for d7dkz4_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dkz4_ f.43.1.0 (4:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} kgewlpglaspgyltgslpgdngfdplglaedpenlkwfvqaelvngrwamlgvagmllp evftsigiinvpkwydagkeeyfassstlfviefilfhyveirrwqdiknpgsvnqdpif kqyslpagevgypggifnplnfaptleakekeiangrlamlaflgfiiqhnvtgkgpfdn llqhisdpwhntivq
Timeline for d7dkz4_: