Lineage for d7jqzf_ (7jqz F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2509576Species Burkholderia cenocepacia [TaxId:406425] [402020] (1 PDB entry)
  8. 2509582Domain d7jqzf_: 7jqz F: [402129]
    automated match to d4dm7d_

Details for d7jqzf_

PDB Entry: 7jqz (more details), 2.2 Å

PDB Description: crystal structure of cfl2 wild-type from burkholderia cenocepacia
PDB Compounds: (F:) Alpha/beta hydrolase fold

SCOPe Domain Sequences for d7jqzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jqzf_ c.69.1.0 (F:) automated matches {Burkholderia cenocepacia [TaxId: 406425]}
tpyfredprltgfrhrfdtvdgvrlhfveggradgetivllagfpeswyawrrvmpllad
efrivapdlpgqgdsdrplvgydtqtvaatlarllerqniarfylaahdvgawvaypfaa
mypesvkrlalldagipgvtlpaalpiepgnawrtwhfafhtvadlpetliagkereyld
wflrrkaanpesfsdadvdeylrvftrdgglraglafyravsessaqnrklqalgklkmp
vlavsadqgsipdmagplehvaeevtaatiaysghfipeeqpqalarelrdffr

SCOPe Domain Coordinates for d7jqzf_:

Click to download the PDB-style file with coordinates for d7jqzf_.
(The format of our PDB-style files is described here.)

Timeline for d7jqzf_: