Lineage for d1d7ya3 (1d7y A:309-405)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1422939Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 1422940Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 1422941Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 1423051Protein NADH-dependent ferredoxin reductase, BphA4 [55434] (1 species)
  7. 1423052Species Pseudomonas sp., KKS102 [TaxId:306] [55435] (9 PDB entries)
  8. 1423059Domain d1d7ya3: 1d7y A:309-405 [40204]
    Other proteins in same PDB: d1d7ya1, d1d7ya2
    complexed with fad

Details for d1d7ya3

PDB Entry: 1d7y (more details), 2.1 Å

PDB Description: crystal structure of nadh-dependent ferredoxin reductase, bpha4
PDB Compounds: (A:) Ferredoxin reductase

SCOPe Domain Sequences for d1d7ya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7ya3 d.87.1.1 (A:309-405) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]}
tapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivgatcv
nnardfaplrrllavgakpdraaladpatdlrklaaa

SCOPe Domain Coordinates for d1d7ya3:

Click to download the PDB-style file with coordinates for d1d7ya3.
(The format of our PDB-style files is described here.)

Timeline for d1d7ya3: