Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins) contains an additional helix in one of the crossover connections |
Protein automated matches [190141] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189956] (4 PDB entries) |
Domain d7e0ea_: 7e0e A: [402029] automated match to d3oq3a_ complexed with gol, po4 |
PDB Entry: 7e0e (more details), 2.1 Å
SCOPe Domain Sequences for d7e0ea_:
Sequence, based on SEQRES records: (download)
>d7e0ea_ a.26.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} phtynlrnkralkvlaqmrrlpflsclkdrqdfgfplekvdnqqiqkaqaipvlrdltqq tlnlftskassaawnttlldsfcndlhqqlndlqtclmqqvgvqeppltqedallavrky fhritvylrekkhspcawevvraevwralsssvnllpr
>d7e0ea_ a.26.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} phtynlrnkralkvlaqmrrlpflsclkdrqdfgfplekvdnqqiqkaqaipvlrdltqq tlnlftskassaawnttlldsfcndlhqqlndlqtcppltqedallavrkyfhritvylr ekkhspcawevvraevwralsssvnllpr
Timeline for d7e0ea_: