Lineage for d7e0ea_ (7e0e A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318696Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2318697Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2319033Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 2319133Protein automated matches [190141] (2 species)
    not a true protein
  7. 2319141Species Mouse (Mus musculus) [TaxId:10090] [189956] (4 PDB entries)
  8. 2319145Domain d7e0ea_: 7e0e A: [402029]
    automated match to d3oq3a_
    complexed with gol, po4

Details for d7e0ea_

PDB Entry: 7e0e (more details), 2.1 Å

PDB Description: crystal structure of mouse interferon alpha2 at 2.1 angstrom resolution
PDB Compounds: (A:) Interferon alpha-2

SCOPe Domain Sequences for d7e0ea_:

Sequence, based on SEQRES records: (download)

>d7e0ea_ a.26.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
phtynlrnkralkvlaqmrrlpflsclkdrqdfgfplekvdnqqiqkaqaipvlrdltqq
tlnlftskassaawnttlldsfcndlhqqlndlqtclmqqvgvqeppltqedallavrky
fhritvylrekkhspcawevvraevwralsssvnllpr

Sequence, based on observed residues (ATOM records): (download)

>d7e0ea_ a.26.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
phtynlrnkralkvlaqmrrlpflsclkdrqdfgfplekvdnqqiqkaqaipvlrdltqq
tlnlftskassaawnttlldsfcndlhqqlndlqtcppltqedallavrkyfhritvylr
ekkhspcawevvraevwralsssvnllpr

SCOPe Domain Coordinates for d7e0ea_:

Click to download the PDB-style file with coordinates for d7e0ea_.
(The format of our PDB-style files is described here.)

Timeline for d7e0ea_: