Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries) |
Domain d7jo7b1: 7jo7 B:860-949 [402018] Other proteins in same PDB: d7jo7a2, d7jo7b2, d7jo7c2, d7jo7d2 automated match to d2h3lb_ complexed with edo |
PDB Entry: 7jo7 (more details), 2.44 Å
SCOPe Domain Sequences for d7jo7b1:
Sequence, based on SEQRES records: (download)
>d7jo7b1 b.36.1.1 (B:860-949) automated matches {Homo sapiens [TaxId: 9606]} rhvaclarserglgfsiaggkgstpyragdagifvsriaeggaahragtlqvgdrvlsin gvdvtearhdhavslltaasptialllere
>d7jo7b1 b.36.1.1 (B:860-949) automated matches {Homo sapiens [TaxId: 9606]} rhvaclarerglgfsiaggkgstpyragdagifvsriaegahrgtlqvgdrvlsingvdv tearhdhavslltasptialllere
Timeline for d7jo7b1: