Lineage for d7jo7b1 (7jo7 B:860-949)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395833Protein automated matches [190055] (6 species)
    not a true protein
  7. 2395842Species Human (Homo sapiens) [TaxId:9606] [187785] (61 PDB entries)
  8. 2395935Domain d7jo7b1: 7jo7 B:860-949 [402018]
    Other proteins in same PDB: d7jo7a2, d7jo7b2, d7jo7c2, d7jo7d2
    automated match to d2h3lb_
    complexed with edo

Details for d7jo7b1

PDB Entry: 7jo7 (more details), 2.44 Å

PDB Description: crystal structure of human scribble pdz2
PDB Compounds: (B:) Protein scribble homolog

SCOPe Domain Sequences for d7jo7b1:

Sequence, based on SEQRES records: (download)

>d7jo7b1 b.36.1.1 (B:860-949) automated matches {Homo sapiens [TaxId: 9606]}
rhvaclarserglgfsiaggkgstpyragdagifvsriaeggaahragtlqvgdrvlsin
gvdvtearhdhavslltaasptialllere

Sequence, based on observed residues (ATOM records): (download)

>d7jo7b1 b.36.1.1 (B:860-949) automated matches {Homo sapiens [TaxId: 9606]}
rhvaclarerglgfsiaggkgstpyragdagifvsriaegahrgtlqvgdrvlsingvdv
tearhdhavslltasptialllere

SCOPe Domain Coordinates for d7jo7b1:

Click to download the PDB-style file with coordinates for d7jo7b1.
(The format of our PDB-style files is described here.)

Timeline for d7jo7b1: