SCOPe 2.07: Domain d7d5ud_: 7d5u D:

Lineage for d7d5ud_ (7d5u D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d7d5ud_: 7d5u D: [401933]
   Other proteins in same PDB: d7d5ua_
   automated match to d4y5vg_
   complexed with gx6

Details for d7d5ud_

PDB Entry: 7d5u, 2.04 Å

PDB Description: bace2 xaperone complex with n-{3-[(9s)-7-amino-2,2-difluoro-9-(prop-1- yn-1-yl)-6-oxa-8-azaspiro[3.5]non-7-en-9-yl]-4-fluorophenyl}-5- cyanopyridine-2-carboxamide

PDB Compounds: (D:) xaperone

SCOPe Domain Sequences for d7d5ud_:

Sequence; same for both SEQRES and ATOM records:

>d7d5ud_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitt
yadsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvssh

Timeline for d7d5ud_:

• d7d5ud_ is new in SCOPe 2.07-stable
  
• d7d5ud_ appears in the current release, SCOPe 2.08